PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1726060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 160aa    MW: 18048.9 Da    PI: 11.0941
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1726060.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.76.1e-162989257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     r+R+t+++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  Lj4g3v1726060.1 29 RSRWTPKPEQILILESIFNSgMVNPPKEETFRIRKLLekfgTVGDANVFYWFQNRRSRSRR 89
                     89*****************99******************9******************997 PP

2Wus_type_Homeobox107.29.9e-352891265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RWtP+peQi iLe++++sG+++P+kee+ ri++ Le++G ++d+NVfyWFQNr++R+r++q
    Lj4g3v1726060.1 28 VRSRWTPKPEQILILESIFNSGMVNPPKEETFRIRKLLEKFGTVGDANVFYWFQNRRSRSRRRQ 91
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-152297IPR009057Homeodomain-like
PROSITE profilePS5007110.9482590IPR001356Homeobox domain
SMARTSM003893.5E-62794IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-92995IPR009057Homeodomain-like
PfamPF000469.2E-142989IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MEDQEGESPD PNSPTQGSSS SESRTGPVRS RWTPKPEQIL ILESIFNSGM VNPPKEETFR  60
IRKLLEKFGT VGDANVFYWF QNRRSRSRRR QRQMQASAAQ PVVQTHFLST PSTTTSTLQV  120
LLLLPKVLVL HLSLLILLHL TSLVPLHHAV VVVVVVFKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007029940.12e-39WUSCHEL related homeobox 11
TrEMBLA0A061F1792e-39A0A061F179_THECC; WUSCHEL related homeobox 11
STRINGPOPTR_0013s06310.19e-39(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58983152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.13e-35WUSCHEL related homeobox 11